{"product_id":"proteintech-23998-1-ap","title":"Proteintech, 23998-1-AP, ANKRD13A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANKRD13A (23998-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD13A in WB, ELISA applications with reactivity to human samples\n23998-1-AP targets ANKRD13A in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, Jurkat cells,  LNCaP cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANKRD13A, also named ANKRD13, is a 590 amino acid protein that contains two ANK repeats and four UIM (ubiquitin-interacting motif) repeats. ANKRD13A localizes in the cell membrane. ANKRD13A is an ubiquitin-binding protein that specifically recognizes and binds 'Lys-63'-linked ubiquitin, but does not bind 'Lys-48'-linked ubiquitin. ANKRD13A positively regulates the internalization of ligand-activated EGFR by binding to the Ub moiety of ubiquitinated EGFR at the cell membrane.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21200 Product name: Recombinant human ANKRD13A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 499-590 aa of BC032833 Sequence: SSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLCPSALSETSRFDNDLQLAMELSAKELEEWELRLQEEEAELQQVLQLSLTDK Predict reactive species\nFull Name: ankyrin repeat domain 13A\nCalculated Molecular Weight: 590 aa, 68 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC032833\nGene Symbol: ANKRD13A\nGene ID (NCBI): 88455\nRRID: AB_2879397\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q8IZ07\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869635596457,"sku":"23998-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-23998-1-ap","provider":"Iright","version":"1.0","type":"link"}