{"product_id":"proteintech-24009-1-ap","title":"Proteintech, 24009-1-AP, GPR108 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR108 (24009-1-AP) by Proteintech is a Polyclonal antibody targeting GPR108 in WB, IHC, ELISA applications with reactivity to human,  mouse,  rat samples\n24009-1-AP targets GPR108 in WB, IF, IHC, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: human kidney tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPR108 is a seven-transmembrane family protein that falls in the GPCRs superfamily (PMID:30332431). GPR108 was identified as a highly conserved AAV entry factor implicated in cellular immune responses to AAV (PMID:31784416). Of note is its role in activating nuclear factor kappa-B (NF-κB) signaling, which implied the potential involvement of GPR108 in inflammation-related diseases as well as cancers through dysregulating NF-κB activity (PMID:35659621).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20887 Product name: Recombinant human GPR108 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 433-543 aa of BC007862 Sequence: SVAVNLAKLKLFRHYYVMVICYVYFTRIIAILLQVAVPFQWQWLYQLLVEGSTLAFFVLTGYKFQPTGNNPYLQLPQEDEEDVQMEQVMTDSGFREGLSKVNKTASGRELL Predict reactive species\nFull Name: G protein-coupled receptor 108\nCalculated Molecular Weight: 61 kDa\nObserved Molecular Weight: 61-70 kDa\nGenBank Accession Number: BC007862\nGene Symbol: GPR108\nGene ID (NCBI): 56927\nRRID: AB_2879401\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q9NPR9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869546041513,"sku":"24009-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24009-1-ap","provider":"Iright","version":"1.0","type":"link"}