{"product_id":"proteintech-24025-1-ap","title":"Proteintech, 24025-1-AP, GALNT8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GALNT8 (24025-1-AP) by Proteintech is a Polyclonal antibody targeting GALNT8 in WB, ELISA applications with reactivity to human samples\n24025-1-AP targets GALNT8 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, MCF-7 cells,  SH-SY5Y cells,  Y79 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGALNT8 (Probable polypeptide N-acetylgalactosaminyltransferase 8) is a member of the UDP-GalNAc polypeptide N-acetylgalactosaminyl transferase (ppGaNTase) family, which initiates mucin-like O-linked protein glycosylation in the Golgi apparatus.  The tissue distribution of GALNT8 is high in the heart, skeletal muscle, kidney and liver; moderate in the placenta, small intestine, leukocyte and lung; and weak in the brain, colon, thymus and spleen (PMID: 34576978). The overexpression of GALNT8 significantly promotes the cell cycle and proliferation of CRC cell lines and correlates with poor prognosis in patients with CRC. GALNT8 encodes a 637-amino-acid type-II membrane protein (GalNAc-T8). The detected molecular weight of GALNT8 (95 kDa) is much higher than the theoretical molecular weight (70 kDa) due to three N-GlcNAc sites (N85, N107 and N160) (PMID: 34743989, 34239555).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21185 Product name: Recombinant human GALNT8 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 522-637 aa of BC140889 Sequence: MYYCHEFSSQNVYYHLTGELYVGQLIAEASASDRCLTDPGKAEKPTLEPCSKAAKNRLHIYWDFKPGGAVINRDTKRCLEMKKDLLGSHVLVLQTCSTQVWEIQHTVRDWGQTNSQ Predict reactive species\nFull Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 8 (GalNAc-T8)\nCalculated Molecular Weight: 637 aa, 73 kDa\nObserved Molecular Weight: 73 kDa, 95 kDa\nGenBank Accession Number: BC140889\nGene Symbol: GALNT8\nGene ID (NCBI): 26290\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NY28\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887646888105,"sku":"24025-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24025-1-ap","provider":"Iright","version":"1.0","type":"link"}