{"product_id":"proteintech-24030-1-ap","title":"Proteintech, 24030-1-AP, CMC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CMC1 (24030-1-AP) by Proteintech is a Polyclonal antibody targeting CMC1 in WB, IP, IHC, ELISA applications with reactivity to human,  mouse samples\n24030-1-AP targets CMC1 in WB, IP, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, mouse liver tissue\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21224 Product name: Recombinant human CMC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC052644 Sequence: MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM Predict reactive species\nFull Name: COX assembly mitochondrial protein homolog (S. cerevisiae)\nCalculated Molecular Weight: 106 aa, 12 kDa\nObserved Molecular Weight: 12-15 kDa\nGenBank Accession Number: BC052644\nGene Symbol: CMC1\nGene ID (NCBI): 152100\nRRID: AB_2879409\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z7K0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869657714857,"sku":"24030-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24030-1-ap","provider":"Iright","version":"1.0","type":"link"}