{"product_id":"proteintech-24091-1-ap","title":"Proteintech, 24091-1-AP, SPRED2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPRED2 (24091-1-AP) by Proteintech is a Polyclonal antibody targeting SPRED2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n24091-1-AP targets SPRED2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-12 cells, MCF-7 cells,  mouse testis tissue,  mouse brain tissue,  rat brain tissue,  T-47D cells,  rat testis tissue\nPositive IHC detected in: rat testis tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPRED2 is a member of the SPRED family of proteins that modulate GFR signaling by inhibiting the Ras-MAPK cascade (PMID: 17094949). SPRED family members are characterized by an N-terminal Enabled\/VASP homology 1 domain (EVH1), a central c-Kit binding domain (KBD) and a C-terminal Sprouty-related domain (SPR) (PMID: 17691106). Three mammalian SPREDs (SPRED1-3) have been described. In adult tissues, SPRED2 is expressed ubiquitously, but most highly expressed in glandular epithelia (PMID: 15580519; 17691106). Reduced expression level of SPRED2 has been reported in human hepatocellular carcinoma (HCC), suggesting SPRED2 may play a role in tumorgenesis (PMID: 16652141). Gene disruption of SPRED2 causes dwarfism (PMID: 15946934).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21359 Product name: Recombinant human SPRED2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 122-214 aa of BC136334 Sequence: LIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPYRQVSFPDDDEEI Predict reactive species\nFull Name: sprouty-related, EVH1 domain containing 2\nCalculated Molecular Weight: 418 aa, 48 kDa\nObserved Molecular Weight: 40-48 kDa\nGenBank Accession Number: BC136334\nGene Symbol: SPRED2\nGene ID (NCBI): 200734\nRRID: AB_2879429\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q7Z698\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868989804713,"sku":"24091-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24091-1-ap","provider":"Iright","version":"1.0","type":"link"}