{"product_id":"proteintech-24104-1-ap","title":"Proteintech, 24104-1-AP, HACE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HACE1 (24104-1-AP) by Proteintech is a Polyclonal antibody targeting HACE1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n24104-1-AP targets HACE1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  HeLa cells\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHACE1(E3 ubiquitin-protein ligase HACE1) also named as KIAA1320, has a tumor-suppressor function dependent on its E3 ligase activity and controlling  cell cycle progression during cell stress through degradation of cyclin D1. It belongs to the HECT family of E3 ubiqutin protein ligase. This protein has 4 isoforms produced by alternative splicing with the molecular weight of 102 kDa, 36 kDa, 64 kDa and 78 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21130 Product name: Recombinant human HACE1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 564-909 aa of BC034982 Sequence: RSSCEVVSKANCAKLKQGIAVRFHGEEGMGQGVVREWFDILSNEIVNPDYALFTQSADGTTFQPNSNSYVNPDHLNYFRFAGQILGLALNHRQLVNIYFTRSFYKHILGIPVNYQDVASIDPEYAKNLQWILDNDISDLGLELTFSVETDVFGAMEEVPLKPGGGSILVTQNNKAEYVQLVTELRMTRAIQPQINAFLQGFHMFIPPSLIQLFDEYELELLLSGMPEIDVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALHCGSYGYTMA Predict reactive species\nFull Name: HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1\nCalculated Molecular Weight: 909 aa, 102 kDa\nObserved Molecular Weight: 78 kDa\nGenBank Accession Number: BC034982\nGene Symbol: HACE1\nGene ID (NCBI): 57531\nRRID: AB_2879432\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IYU2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868998979753,"sku":"24104-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24104-1-ap","provider":"Iright","version":"1.0","type":"link"}