{"product_id":"proteintech-24137-1-ap","title":"Proteintech, 24137-1-AP, ZMAT4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZMAT4 (24137-1-AP) by Proteintech is a Polyclonal antibody targeting ZMAT4 in WB, ELISA applications with reactivity to human,   mouse samples\n24137-1-AP targets ZMAT4 in WB, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZinc finger protein 4 (ZMAT4) is a member of the zinc finger (ZNF) family and has two isoforms. It is normally found in the nucleus and is associated with DNA binding, metal ion binding and zinc ion binding. The copy number variation (CNV) of its depository ZMAT4 has the potential to be used as a diagnostic indicator of hematologic malignancies, either alone or in combination with other markers. ( PMID: 21269563)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21346 Product name: Recombinant human ZMAT4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 105-153 aa of BC019598 Sequence: LLLGEKTPLKTTGLRRNYRCAICSVSLNSIEQYHAHLKGSKHQTNLKNK Predict reactive species\nFull Name: zinc finger, matrin type 4\nCalculated Molecular Weight: 229 aa, 26 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC019598\nGene Symbol: ZMAT4\nGene ID (NCBI): 79698\nRRID: AB_3085724\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q9H898\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887937212585,"sku":"24137-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24137-1-ap","provider":"Iright","version":"1.0","type":"link"}