{"product_id":"proteintech-24148-1-ap","title":"Proteintech, 24148-1-AP, COL9A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COL9A2 (24148-1-AP) by Proteintech is a Polyclonal antibody targeting COL9A2 in WB, ELISA applications with reactivity to mouse samples\n24148-1-AP targets COL9A2 in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse ovary tissue, mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThis gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. This chain is unusual in that, unlike the other two type IX alpha chains, it contains a covalently attached glycosaminoglycan side chain. Mutations in this gene are associated with multiple epiphyseal dysplasia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21458 Product name: Recombinant human COL9A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 278-406 aa of BC136326 Sequence: EKGDEGSPGIRGPQGITGPKGATGPPGINGKDGTPGTPGMKGSAGQAGQPGSPGHQGLAGVPGQPGTKGGPGDQGEPGPQGLPGFSGPPGKEGEPGPRGEIGPQGIMGQKGDQGERGPVGQPGPQGRQG Predict reactive species\nFull Name: collagen, type IX, alpha 2\nCalculated Molecular Weight: 689 aa, 65 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC136326\nGene Symbol: COL9A2\nGene ID (NCBI): 1298\nRRID: AB_3085726\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q14055\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886755926185,"sku":"24148-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24148-1-ap","provider":"Iright","version":"1.0","type":"link"}