{"product_id":"proteintech-24209-1-ap","title":"Proteintech, 24209-1-AP, COA6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COA6 (24209-1-AP) by Proteintech is a Polyclonal antibody targeting COA6 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n24209-1-AP targets COA6 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse liver tissue\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC1orf31, also known as COA6, is a conserved mitochondrial protein required for respiratory complex IV biogenesis. Recently study reported that C1orf31 is required for maintenance of cytochrome c oxidase (CcO) subunit levels, and has role in the Cu delivery pathway to CcO. Defects in C1orf31 is associated with mitochondrial respiratory chain disease (MRCD). (24549041)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21525 Product name: Recombinant human C1orf31 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 47-125 aa of BC116455 Sequence: MAAPSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTAKS Predict reactive species\nFull Name: chromosome 1 open reading frame 31\nCalculated Molecular Weight: 125 aa, 14 kDa\nObserved Molecular Weight: 10 - 18 kDa\nGenBank Accession Number: BC116455\nGene Symbol: COA6\nGene ID (NCBI): 388753\nRRID: AB_2879459\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q5JTJ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868995735721,"sku":"24209-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24209-1-ap","provider":"Iright","version":"1.0","type":"link"}