{"product_id":"proteintech-24215-1-ap","title":"Proteintech, 24215-1-AP, GJB6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GJB6 (24215-1-AP) by Proteintech is a Polyclonal antibody targeting GJB6 in IHC, ELISA applications with reactivity to human samples\n24215-1-AP targets GJB6 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human oesophagus tissue,  human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGap junctions form conduits between adjacent cells that are composed of connexin protein subunits and provide direct intercellular communication pathways allowing rapid exchange of ions and metabolites (PMID: 12126230; 15094343). Connexins are four-pass transmembrane proteins with amino- and carboxy-terminal regions facing the cytoplasm. A connexon is composed of a hexamer of connexins. GJB6 (gap junction beta-6 protein, also known as connexin-30) is a member of the connexin family of proteins. GJB6 is a component of the gap junction networks of the cochlea.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21529 Product name: Recombinant human GJB6 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 182-261 aa of BC038934 Sequence: ISRPTEKTVFTIFMISASVICMLLNVAELCYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFPS Predict reactive species\nFull Name: gap junction protein, beta 6, 30kDa\nCalculated Molecular Weight: 261 aa, 30 kDa\nGenBank Accession Number: BC038934\nGene Symbol: GJB6\nGene ID (NCBI): 10804\nRRID: AB_2879461\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: O95452\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887651475625,"sku":"24215-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24215-1-ap","provider":"Iright","version":"1.0","type":"link"}