{"product_id":"proteintech-24306-1-ap","title":"Proteintech, 24306-1-AP, ISLR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ISLR (24306-1-AP) by Proteintech is a Polyclonal antibody targeting ISLR in WB, IHC, IF\/ICC, ELISA applications with reactivity to mouse samples\n24306-1-AP targets ISLR in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, rat thyroid gland tissue,  mouse retina tissue\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells, A549 cells,  SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Immunoglobulin superfamily containing leucine-rich repeat protein(ISLR), is involved in various biological events, such as embryonic development, Gaucher's disease, and replicative senescence of fibroblasts in some organs, including the heart, pancreas, and bone marrow. ISLR, also known as meflin, is a newly discovered marker of mesenchymal stem cells, which is involved in pathological fibrosis and the cancer microenvironment. (PMID: 34713300)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19446 Product name: Recombinant human ISLR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 318-402 aa of BC022478 Sequence: GKLEEGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFHGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAE Predict reactive species\nFull Name: immunoglobulin superfamily containing leucine-rich repeat\nCalculated Molecular Weight: 428 aa, 46 kDa\nObserved Molecular Weight: 44-46 kDa\nGenBank Accession Number: BC022478\nGene Symbol: ISLR\nGene ID (NCBI): 3671\nRRID: AB_3085729\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14498\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887686996137,"sku":"24306-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24306-1-ap","provider":"Iright","version":"1.0","type":"link"}