{"product_id":"proteintech-24309-1-ap","title":"Proteintech, 24309-1-AP, MYLK4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYLK4 (24309-1-AP) by Proteintech is a Polyclonal antibody targeting MYLK4 in WB, IP, IHC, ELISA applications with reactivity to human samples\n24309-1-AP targets MYLK4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, L02 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human heart tissue,  human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYLK4(Myosin light chain kinase family member 4) is also named as SGK085 and belongs to the CAMK Ser\/Thr protein kinase family. MLCKs are activated by Ca2+-calmodulin complexes and require Mg2+ or Ca2+ as a co-factor. It has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19314 Product name: Recombinant human MYLK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4-110 aa of BC132831 Sequence: VKRLEEFNTCYNSNQLEKMAFFQCREEVEKVKCFLEKNSGDQDSRSRHNEAKEVWSNADLTERMPVKSKRTSALAVDIPAPPAPFDHRIVTAKQGAVNSFYTVSKTE Predict reactive species\nFull Name: myosin light chain kinase family, member 4\nCalculated Molecular Weight: 388 aa, 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC132831\nGene Symbol: MYLK4\nGene ID (NCBI): 340156\nRRID: AB_2877632\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86YV6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869475197097,"sku":"24309-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24309-1-ap","provider":"Iright","version":"1.0","type":"link"}