{"product_id":"proteintech-24324-1-ap","title":"Proteintech, 24324-1-AP, Sodium iodide symporter Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Sodium iodide symporter (24324-1-AP) by Proteintech is a Polyclonal antibody targeting Sodium iodide symporter in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n24324-1-AP targets Sodium iodide symporter in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, mouse stomach tissue,  SGC-7901 cells,  rat stomach tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: mouse stomach tissue, human ovary tissue,  human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe sodium iodide symporter (Na+\/I - symporter, NIS), encoded by SLC5A5, is an integral plasma membrane glycoprotein that plays an important role in iodide uptake by thyroid cells. Expression of sodium iodide symporter has also been found in extra-thyroidal tissues, including gastric mucosa, lactating mammary gland and salivary glands. Increased expression of sodium iodide symporter has been found in thyroid tissue from patients with Graves' disease as well as papillary thyroid carcinomas. In addition, sodium iodide symporter was found to express in majority of breast cancer tissue but not in normal tissue. Sodium iodide symporter can be a promising diagnostic and therapeutic tool for thyroid cancer and breast cancer. This antibody recognizes the mature approximately 75-100 kDa protein and a partially glycosylated 50-55 kDa protein. (PMID: 12588808, 9525971)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19504 Product name: Recombinant human SLC5A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 538-643 aa of BC105047 Sequence: TVLCGALISCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL Predict reactive species\nFull Name: solute carrier family 5 (sodium iodide symporter), member 5\nCalculated Molecular Weight: 643 aa, 69 kDa\nObserved Molecular Weight: 50-55 kDa, 75-100 kDa\nGenBank Accession Number: BC105047\nGene Symbol: Sodium iodide symporter\nGene ID (NCBI): 6528\nRRID: AB_2879495\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92911\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868840382633,"sku":"24324-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24324-1-ap","provider":"Iright","version":"1.0","type":"link"}