{"product_id":"proteintech-24399-1-ap","title":"Proteintech, 24399-1-AP, GPATCH4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPATCH4 (24399-1-AP) by Proteintech is a Polyclonal antibody targeting GPATCH4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n24399-1-AP targets GPATCH4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: human liver tissue,  human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPATCH4 (G patch domain-containing protein 4) is a 446 amino acid protein containing one G-patch domain. Existing as three \nalternatively spliced isoforms. This antibody is a rabbit polyclonal antibody raised against the 189 residues of N-terminal of human GPATCH4 protein\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20095 Product name: Recombinant human GPATCH4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-189 aa of BC040147 Sequence: MKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTHGVGHDPAKEFTNHWWNELFNKTAANLVVETGQDGVQIRSLSKETTRYNHPKPNLLYQKFVKMATLTSGGEKPNKDLESCSDDDNQGSKSPKILTDEMLLQACEGRTAHKAARLGITMKAKLARLEAQEQAFLARLKGQDPGAPQLQSESK Predict reactive species\nFull Name: G patch domain containing 4\nCalculated Molecular Weight: 446 aa, 50 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC040147\nGene Symbol: GPATCH4\nGene ID (NCBI): 54865\nRRID: AB_2879523\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5T3I0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869688647849,"sku":"24399-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24399-1-ap","provider":"Iright","version":"1.0","type":"link"}