{"product_id":"proteintech-24401-1-ap","title":"Proteintech, 24401-1-AP, Collagen Type XXVIII Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Collagen Type XXVIII (24401-1-AP) by Proteintech is a Polyclonal antibody targeting Collagen Type XXVIII in WB, IF\/ICC, ELISA applications with reactivity to human samples\n24401-1-AP targets Collagen Type XXVIII in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOL28A1 (collagen type XXVIII alpha 1 chain), also known as COL28. It is expected to be located in the basement membranes, cytoplasm and nucleus. And the protein is mainly expressed in salivary gland and adrenal. This antibody can recognize the 117 kDa and 72 kDa isoforms of target. COL28A1 is a new collagen that cannot clearly be assigned to any collagen subgroup, despite the fact that it contains VWA domains. Ongoing investigations will shed further light on the role of COL28A1 in the assembly of nerve fiber basement membranes. Although no human mutation has been associated with COL28A1, it is tempting to speculate that mutations in this gene would lead to neurodegenerative disease (PMID: 16330543).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21459 Product name: Recombinant human COL28A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-295 aa of BC136892 Sequence: LARKSDVQGSICFIDIVFIVDSSESSKIALFDKQKDFVDSLSDKIFQLTPGRSLEYDIKLAALQFSSSVQIDPPFSSWKDLQTFKQKVKSMNLIGQGTFSYYAISNATRLLKREGRKDGVKVVLLMTDGIDHPKNPDVQSISEDARISGISFITIGLSTVVNEAKLRLISGDSSSEPTLLLSDPTLVDKIQDRLDILFEKKCERKICECEKGDPGDPGPPGTHGNPGIKGERGPKGNPGNAQKGEAGERGPGGIPGYKGDKG Predict reactive species\nFull Name: collagen, type XXVIII, alpha 1\nCalculated Molecular Weight: 1125 aa, 117 kDa\nObserved Molecular Weight: 72 kDa, 100-117 kDa\nGenBank Accession Number: BC136892\nGene Symbol: COL28A1\nGene ID (NCBI): 340267\nRRID: AB_3669435\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q2UY09\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886777127081,"sku":"24401-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24401-1-ap","provider":"Iright","version":"1.0","type":"link"}