{"product_id":"proteintech-24418-1-ap","title":"Proteintech, 24418-1-AP, CHAT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHAT (24418-1-AP) by Proteintech is a Polyclonal antibody targeting CHAT in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n24418-1-AP targets CHAT in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue,  human placenta tissue,  mouse brain tissue\nPositive IP detected in: rat brain tissue\nPositive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHAT (choline acetyltransferase) belongs to the carnitine\/choline acetyltransferase family. It catalyzes the reversible synthesis of acetylcholine (ACh) from acetyl CoA and choline at cholinergic synapses. Defects in CHAT are the cause of congenital myasthenic syndrome with episodic apnea (CMSEA). CHAT is known to to be present exclusively in the cytoplasm of cholinergic neurons and anti-CHAT antibody has been considered as the best marker for cholinergic neurons. It has been observed that CHAT gene generates multiple mRNA splice variants, including peripheral type CHAT (pCHAT) and common type CHAT (cCHAT), encoding 40-55 kDa and 66-70 kDa forms of proteins, respectively.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19550 Product name: Recombinant human CHAT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-630 aa of BC130617 Sequence: SDTHRALQLLHGGGYSKNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMTQSSRKLIRADSVSELPAPRRLRWKCSPEIQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPASEKLLLLKDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPSQGHQP Predict reactive species\nFull Name: choline acetyltransferase\nCalculated Molecular Weight: 748 aa, 83 kDa\nObserved Molecular Weight: 60-66 kDa, 45 kDa\nGenBank Accession Number: BC130617\nGene Symbol: CHAT\nGene ID (NCBI): 1103\nRRID: AB_2879536\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P28329\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868978335913,"sku":"24418-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24418-1-ap","provider":"Iright","version":"1.0","type":"link"}