{"product_id":"proteintech-24423-1-ap","title":"Proteintech, 24423-1-AP, SPAG9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPAG9 (24423-1-AP) by Proteintech is a Polyclonal antibody targeting SPAG9 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n24423-1-AP targets SPAG9 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  RAW 264.7 cells\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19763 Product name: Recombinant human SPAG9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 199-273 aa of BC146755 Sequence: ERPISLGIFPLPAGDGLLTPDAQKGGETPGSEQWKFQELSQPRSHTSLKVSNSPEPQKAVEQEDELSDVSQGGSK Predict reactive species\nFull Name: sperm associated antigen 9\nCalculated Molecular Weight: 1321 aa, 146 kDa\nObserved Molecular Weight: 146 kDa\nGenBank Accession Number: BC146755\nGene Symbol: SPAG9\nGene ID (NCBI): 9043\nRRID: AB_2879541\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60271\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887813054633,"sku":"24423-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24423-1-ap","provider":"Iright","version":"1.0","type":"link"}