{"product_id":"proteintech-24425-1-ap","title":"Proteintech, 24425-1-AP, PCMTD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCMTD1 (24425-1-AP) by Proteintech is a Polyclonal antibody targeting PCMTD1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n24425-1-AP targets PCMTD1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat liver tissue, human placenta tissue,  hTERT-RPE1 cells,  mouse eye tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein-l-isoaspartate O-methyltransferase domain-containing protein 1 (PCMTD1) is a putative E3 ubiquitin ligase substrate adaptor protein, which has a C-terminal domain containing SOCS-box ubiquitin ligase recruitment motifs. PCMTD1 protein may provide an alternate maintenance pathway for modified proteins in mammalian cells (PMID: 35486881). This antibody can detect two isoforms of PCMTD1, 27 kDa and 41 kDa respectively (PMID: 37953789, 35486881).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19634 Product name: Recombinant human PCMTD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 249-357 aa of BC032670 Sequence: IYIRRTLRNFINDEMQAKGIPQRAPPKRKRKRVKQRINTYVFVGNQLIPQPLDSEEDEKMEEDIKEEEEKDHNEAMKPEEPPQNLLREKIMKLPLPESLKAYLTYFRDK Predict reactive species\nFull Name: protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1\nCalculated Molecular Weight: 357 aa, 41 kDa\nObserved Molecular Weight: 41 kDa, 27 kDa\nGenBank Accession Number: BC032670\nGene Symbol: PCMTD1\nGene ID (NCBI): 115294\nRRID: AB_3669436\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96MG8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887753351337,"sku":"24425-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24425-1-ap","provider":"Iright","version":"1.0","type":"link"}