{"product_id":"proteintech-24490-1-ap","title":"Proteintech, 24490-1-AP, RRP7A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RRP7A (24490-1-AP) by Proteintech is a Polyclonal antibody targeting RRP7A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n24490-1-AP targets RRP7A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse thymus tissue\nPositive IHC detected in: human placenta tissue, human brain tissue,  human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRRP7A, also named as Ribosomal RNA-processing protein 7 homolog A, is a 280 amino acid protein, which belongs to the RRP7 family. The calcualted molecular weight of RRP7A is 32 kDa, but modified RRP7A is about 42 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21636 Product name: Recombinant human RRP7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-176 aa of BC121118 Sequence: MVARRRKCAARDPEDRIPSPLGYAAIPIKFSEKQQASHYLYVRAHGVRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGFQVAYVVFQKPSGVSAALALKGPLLVSTESHPVKSGIHKWISDYADSVPDPEALRVEVDTF Predict reactive species\nFull Name: ribosomal RNA processing 7 homolog A (S. cerevisiae)\nCalculated Molecular Weight: 280 aa, 32 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC121118\nGene Symbol: RRP7A\nGene ID (NCBI): 27341\nRRID: AB_2879570\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y3A4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887789756585,"sku":"24490-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24490-1-ap","provider":"Iright","version":"1.0","type":"link"}