{"product_id":"proteintech-24496-1-ap","title":"Proteintech, 24496-1-AP, Somatostatin (1-116aa) Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Somatostatin (1-116aa) (24496-1-AP) by Proteintech is a Polyclonal antibody targeting Somatostatin (1-116aa) in IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n24496-1-AP targets Somatostatin (1-116aa) in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:4000-1:16000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSomatostatin  is a peptide hormone that regulates the endocrine system and affects neurotransmission and cell proliferation via interaction with G protein-coupled somatostatin receptors and inhibition of the release of numerous secondary hormones. Somatostatin is a useful marker of D-cells of pancreatic islet cells. Somatostatin inhibits ins and glucagon secretion. Somatostatin has two active forms produced by alternative cleavage of a single preproprotein: one of 14 amino acids, the other of 28 amino acids. This antibody can recognize the full length and propeptide of Somatostatin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21294 Product name: Recombinant human SST protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-116 aa of BC032625 Sequence: MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC Predict reactive species\nFull Name: somatostatin\nCalculated Molecular Weight: 13 kDa\nGenBank Accession Number: BC032625\nGene Symbol: Somatostatin\nGene ID (NCBI): 6750\nRRID: AB_2918083\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61278\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869769945257,"sku":"24496-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24496-1-ap","provider":"Iright","version":"1.0","type":"link"}