{"product_id":"proteintech-24499-1-ap","title":"Proteintech, 24499-1-AP, ARID4B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARID4B (24499-1-AP) by Proteintech is a Polyclonal antibody targeting ARID4B in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n24499-1-AP targets ARID4B in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells,  A549 cells,  K-562 cells\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: human pancreas cancer tissue, human breast cancer tissue,  human cervical cancer tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARID4B, also named as BRCAA1 or SAP180, is a 1312 amino acid protein, which contains one ARID domain. ARID4B localizes in the nucleus and cytoplasm. ARID4B as a transcription repressor may function in the assembly and\/or enzymatic activity of the Sin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes. ARID4B is highly expressed in the testis and in breast, lung, colon, pancreatic and ovarian cancers. Expressed at low levels in the thymus, prostate and ovary.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21462 Product name: Recombinant human ARID4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 406-523 aa of BC130418 Sequence: MALPEKVVNKQCKECENVKEIKVKEENETEIKEIKMEEERNIIPREEKPIEDEIERKENIKPSLGSKKNLLESIPTHSDQEKEVNIKKPEDNENLDDKDDDTTRVDESLNIKVEAEEE Predict reactive species\nFull Name: AT rich interactive domain 4B (RBP1-like)\nCalculated Molecular Weight: 1312 aa, 148 kDa\nObserved Molecular Weight: 100 kDa, 200 kDa\nGenBank Accession Number: BC130418\nGene Symbol: ARID4B\nGene ID (NCBI): 51742\nRRID: AB_2879575\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q4LE39\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868992753833,"sku":"24499-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24499-1-ap","provider":"Iright","version":"1.0","type":"link"}