{"product_id":"proteintech-24512-1-ap","title":"Proteintech, 24512-1-AP, STXBP5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STXBP5 (24512-1-AP) by Proteintech is a Polyclonal antibody targeting STXBP5 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n24512-1-AP targets STXBP5 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IP detected in: rat brain tissue\nPositive IF\/ICC detected in: SH-SY5Y cells, HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSyntaxin-binding protein 5 (STXBP5, also known as tomosyn) is a cytosolic syntaxin-binding protein that can displace MUNC18 from syntaxin-1. It is a soluble R-SNARE protein that sequesters target SNAREs through the C-terminal VAMP-like domain. STXBP5 plays a regulatory role in calcium-dependent exocytosis and neurotransmitter release.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21629 Product name: Recombinant human STXBP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 515-610 aa of BC113382 Sequence: MLCIAGVSAHVIIYRFSKQEVITEVIPMLEVRLLYEINDVETPEGEQPPPLPTPVGGSNPQPIPPQSHPSTSSSSSDGLRDNVPCLKVKNSPLKQS Predict reactive species\nFull Name: syntaxin binding protein 5 (tomosyn)\nCalculated Molecular Weight: 1151 aa, 128 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC113382\nGene Symbol: STXBP5\nGene ID (NCBI): 134957\nRRID: AB_2879582\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5T5C0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869773582505,"sku":"24512-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24512-1-ap","provider":"Iright","version":"1.0","type":"link"}