{"product_id":"proteintech-24514-1-ap","title":"Proteintech, 24514-1-AP, ZNF846 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF846 (24514-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF846 in WB, ELISA applications with reactivity to human,  rat samples\n24514-1-AP targets ZNF846 in WB, ELISA applications and shows reactivity with human,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF846 also termed as zinc finger protein 846 is a 533 amino-acid protein, which contains 1 KRAB domain and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF846 localizes in the nucleus and may play an important role in transcription regulation. The function of ZNF846 is still non-known and need to be further studied.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21687 Product name: Recombinant human ZNF846 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-55 aa of BC118657 Sequence: AFTQSTGLKLHIRTHSGEKPYKCKECGKAFTHSSYLTDHTRIHSGKKPYVCMECG Predict reactive species\nFull Name: zinc finger protein 846\nCalculated Molecular Weight: 533 aa, 61 kDa\nObserved Molecular Weight: 62 kDa\nGenBank Accession Number: BC118657\nGene Symbol: ZNF846\nGene ID (NCBI): 162993\nRRID: AB_2879584\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q147U1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887953957033,"sku":"24514-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24514-1-ap","provider":"Iright","version":"1.0","type":"link"}