{"product_id":"proteintech-24553-1-ap","title":"Proteintech, 24553-1-AP, C15orf53 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C15orf53 (24553-1-AP) by Proteintech is a Polyclonal antibody targeting C15orf53 in WB, IHC, ELISA applications with reactivity to human samples\n24553-1-AP targets C15orf53 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells,  COLO 320 cells,  HepG2 cells\nPositive IHC detected in: human tonsillitis tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC15orf53 has been identified on chromosome 15q14. It is probably neither causative for the etiology of BD (Bipolar disorder) nor for SCZD10 (periodic catatonia). Gene expression analysis revealed that C15orf53 was expressed in a subpopulation of leukocytes, but not in human post-mortem limbic brain tissue. In our detection this antibody always detect ~30 kDa band even the amino acids is 20 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18630 Product name: Recombinant human C15orf53 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-179 aa of BC119016 Sequence: MELQGAQEDLGISLSSPRRNHETRPGSKAKGRSSICLQASVWMAGGKLRLRASEHLTQGHQQELRDWNLGEDASLLFSKSPFGAGKLIQAPAHVFRQCWVQGNAWISCITKFDSKRSPEVASSPSYLTVPRRSPLPVFLRPSDRCVCGGCYLGKSTRRRACQSLLSDPLGVTFPTQTRP Predict reactive species\nFull Name: chromosome 15 open reading frame 53\nCalculated Molecular Weight: 179 aa, 20 kDa\nObserved Molecular Weight: ~30 kDa\nGenBank Accession Number: BC119016\nGene Symbol: C15orf53\nGene ID (NCBI): 400359\nRRID: AB_2879605\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NAA6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885459787945,"sku":"24553-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24553-1-ap","provider":"Iright","version":"1.0","type":"link"}