{"product_id":"proteintech-24593-1-ap","title":"Proteintech, 24593-1-AP, POTEA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe POTEA (24593-1-AP) by Proteintech is a Polyclonal antibody targeting POTEA in WB, IHC, ELISA applications with reactivity to human, mouse samples\n24593-1-AP targets POTEA in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: human ovary cancer tissue, human ovary tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPOTEA also named as ANKRD26 like family A member 1 or POTE8 is a 498 amino acid protein, which contains five ANK repeats and belongs to the POTE family. POTEA has an important signaling function in the reproductive system.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20228 Product name: Recombinant human POTEA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 411-498 aa of BC153076 Sequence: IHSVDNLDDITWPSEIASEDYDLLFSNYETFTLLIEQLKMDFNDSASLSKIQDAVISEEHLLELKNSHYEQLTVEVEQMENMVHVLQK Predict reactive species\nFull Name: POTE ankyrin domain family, member A\nCalculated Molecular Weight: 498 aa, 56 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC153076\nGene Symbol: POTEA\nGene ID (NCBI): 340441\nRRID: AB_2879627\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6S8J7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887768785065,"sku":"24593-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24593-1-ap","provider":"Iright","version":"1.0","type":"link"}