{"product_id":"proteintech-24604-1-ap","title":"Proteintech, 24604-1-AP, GALNT13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GALNT13 (24604-1-AP) by Proteintech is a Polyclonal antibody targeting GALNT13 in WB, IHC, ELISA applications with reactivity to human samples\n24604-1-AP targets GALNT13 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPolypeptide N-acetylgalactosaminyltransferase 13 (GALNT13)  is a recently identified member of the UDP-N-acetylgalactosamine: polypeptide N-acetyl galactosaminy transferases family, otherwise known as ppGalNAc-Tases, which control the initiation of mucin-type O-glycosylation. GALNT13 and the trimeric Tn antigen have been considered as tumor-associated antigens, and might be useful prognostic factors in many types of human cancers (PMID: 34830771, 27499036, 36575396)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16526 Product name: Recombinant human GALNT13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 499-561 aa of BC101032 Sequence: MRGNQLWEYDAESCLSVNKVADGSQHPTVETCNDSTLQKWLLRNYTRMEIFRNIFGNSTDYIL Predict reactive species\nFull Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13)\nCalculated Molecular Weight: 561 aa, 65 kDa\nObserved Molecular Weight: 64 kDa\nGenBank Accession Number: BC101032\nGene Symbol: GALNT13\nGene ID (NCBI): 114805\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IUC8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887646724265,"sku":"24604-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24604-1-ap","provider":"Iright","version":"1.0","type":"link"}