{"product_id":"proteintech-24606-1-ap","title":"Proteintech, 24606-1-AP, GRK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GRK1 (24606-1-AP) by Proteintech is a Polyclonal antibody targeting GRK1 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse samples\n24606-1-AP targets GRK1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Y79 cells,  mouse eye tissue\nPositive IP detected in: Y79 cells\nPositive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGRK1(G protein-coupled receptor kinase 1) is also named as RHOK, RK, GPRK1, and belongs to the AGC Ser\/Thr protein kinase family. It is involved in quenching of light-induced signal transduction in the phosphoreceptor. GRK1 is a photoreceptor-specific enzyme that mediates adaptation of photoreceptors to light and protects these cells against light-induced injury.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18063 Product name: Recombinant human GRK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 339-563 aa of BC140945 Sequence: AVELLDGQSKTKGYAGTPGFMAPELLQGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQLEAGMLMPPFIPDSKTVYAKDIQDVGAFSTVKGVAFDKTDTEFFQEFATGNCPIPWQEEMIETGIFGELNVWRSDGQMPDDMKGISGGSSSSSKSGMCLVS Predict reactive species\nFull Name: G protein-coupled receptor kinase 1\nCalculated Molecular Weight: 563 aa, 64 kDa\nObserved Molecular Weight: 64 kDa\nGenBank Accession Number: BC140945\nGene Symbol: GRK1\nGene ID (NCBI): 6011\nRRID: AB_2879635\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15835\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869409562793,"sku":"24606-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24606-1-ap","provider":"Iright","version":"1.0","type":"link"}