{"product_id":"proteintech-24610-1-ap","title":"Proteintech, 24610-1-AP, MBNL3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MBNL3 (24610-1-AP) by Proteintech is a Polyclonal antibody targeting MBNL3 in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n24610-1-AP targets MBNL3 in WB, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue\nPositive IHC detected in: human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMBNL3, also named as Muscleblind-like protein 3 or Cys3His CCG1-required protein, is a 354 amino acid protein, which contains four C3H1-type zinc fingers and belongs to the muscleblind family. MBNL3 localizes in the nucleus and is highly expressed in the placenta. MBNL3 mediates pre-mRNA alternative splicing regulation and plays a role in myotonic dystrophy pathophysiology. MBNL3 could inhibit terminal muscle differentiation, acting at approximately the time of myogenin induction.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20113 Product name: Recombinant human MBNL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 156-230 aa of BC042090 Sequence: SAASAMALQPGTLQLIPKRSALEKPNGATPVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGA Predict reactive species\nFull Name: muscleblind-like 3 (Drosophila)\nCalculated Molecular Weight: 354 aa, 39 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC042090\nGene Symbol: MBNL3\nGene ID (NCBI): 55796\nRRID: AB_2879637\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NUK0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869707489449,"sku":"24610-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24610-1-ap","provider":"Iright","version":"1.0","type":"link"}