{"product_id":"proteintech-24613-1-ap","title":"Proteintech, 24613-1-AP, Angiopoietin 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Angiopoietin 2 (24613-1-AP) by Proteintech is a Polyclonal antibody targeting Angiopoietin 2 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n24613-1-AP targets Angiopoietin 2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, HeLa cells,  HepG2 cells,  K-562 cells\nPositive IF\/ICC detected in: PC-12 cells, A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAngiopoietin-2 (Ang2) is a growth factor belonging to the angiopoietin\/Tie (tyrosine kinase with Ig and EGF homology domains) signaling pathway, one of the main pathways involved in angiogenesis. Angiopoietin-2 was identified through a cDNA library screening, shortly after the identification of angiopoietin-1. Angiopoietin-2, is a natural antagonist for Tie2 that disrupts in vivo angiogenesis. In adult mice and humans, Angiopoietin-2 is expressed only at sites of vascular remodeling. Angiopoietin-2 has also been found to be highly expressed in diverse tumor cells and plays an important role in tumor angiogenesis and inflammation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17938 Product name: Recombinant human ANGPT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 357-443 aa of BC126200 Sequence: NEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTG Predict reactive species\nFull Name: angiopoietin 2\nCalculated Molecular Weight: 496 aa, 57 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC126200\nGene Symbol: Angiopoietin 2\nGene ID (NCBI): 285\nRRID: AB_2879639\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15123\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868856242345,"sku":"24613-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24613-1-ap","provider":"Iright","version":"1.0","type":"link"}