{"product_id":"proteintech-24633-1-ap","title":"Proteintech, 24633-1-AP, LY6G5C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LY6G5C (24633-1-AP) by Proteintech is a Polyclonal antibody targeting LY6G5C in WB, IP, ELISA applications with reactivity to human, mouse samples\n24633-1-AP targets LY6G5C in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue\nPositive IP detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLY6G5C, also known as C6orf20, is a low abundance secreted protein. The function of LY6G5C, remains largely unknown. It may have a role in hematopoietic cell differentiation. Catalog#11714-1-AP can detect the protein and its dimmer and tetramer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18812 Product name: Recombinant human LY6G5C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 41-147 aa of BC141637 Sequence: VPVNWEPPQPLPFPKYLRCYRCLLETKELGCLLGSDICLTPAGSSCITLHKKNSSGSDVMVSDCRSKEQMSDCSNTRTSPVSGFWIFSQYCFLDFCNDPQNRGLYTP Predict reactive species\nFull Name: lymphocyte antigen 6 complex, locus G5C\nCalculated Molecular Weight: 150 aa, 17 kDa\nObserved Molecular Weight: 16 kDa, 32 kDa, 64 kDa\nGenBank Accession Number: BC141637\nGene Symbol: LY6G5C\nGene ID (NCBI): 80741\nRRID: AB_2879647\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5SRR4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869470478505,"sku":"24633-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24633-1-ap","provider":"Iright","version":"1.0","type":"link"}