{"product_id":"proteintech-24660-1-ap","title":"Proteintech, 24660-1-AP, OPN1SW Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OPN1SW (24660-1-AP) by Proteintech is a Polyclonal antibody targeting OPN1SW in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n24660-1-AP targets OPN1SW in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse eye tissue, rat eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOPN1SW (Short-wave-sensitive opsin 1) belongs to the G-protein coupled receptor 1 family, opsin subfamily. It's one of three types of cone photoreceptors responsible for normal color vision. Inherited tritan color vision deficiencies exhibit an autosomal dominant inheritance pattern and are caused by mutations in OPN1SW (PMID: 32400513).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20387 Product name: Recombinant human OPN1SW protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 265-348 aa of BC156719 Sequence: YAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN Predict reactive species\nFull Name: opsin 1 (cone pigments), short-wave-sensitive\nCalculated Molecular Weight: 348 aa, 39 kDa\nGenBank Accession Number: BC156719\nGene Symbol: OPN1SW\nGene ID (NCBI): 611\nRRID: AB_3085746\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P03999\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887746142377,"sku":"24660-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24660-1-ap","provider":"Iright","version":"1.0","type":"link"}