{"product_id":"proteintech-24665-1-ap","title":"Proteintech, 24665-1-AP, ZBTB48 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZBTB48 (24665-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB48 in WB, ELISA applications with reactivity to human samples\n24665-1-AP targets ZBTB48 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZBTB48, also named as TZAP and HKR3, is a 688 amino acid protein, which contains 1 BTB (POZ) domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZBTB48 is detected in adrenal gland and neuroblastoma. ZBTB48 binds to and regulates the J and\/or S elements in MHC II promoter. Zinc finger and BTB domain containing 48 (ZBTB48), also known as telomeric zinc-finger associated protein (TZAP), is a protein that triggers the trimming of telomeres in the absence of shelterin. ZBTB48, is a relatively uncharacterized POK family protein with a POZ-domain and 11 zinc finger domains. ZBTB48, is ubiquitously expressed in human tissues. The ZBTB48 gene is mapped to human chromosome 1p36, which is commonly rearranged (leiomyoma and leukemias) or deleted in various cancers (neuroblastoma, melanoma, Merkel cell carcinomas, pheochromocytoma and breast and colon carcinomas. A correlation between deletions or rearrangements of HKR3 and human cancer suggest a role for ZBTB48 as a potential tumor suppressor.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20301 Product name: Recombinant human ZBTB48 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC013573 Sequence: MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSVGQAAGGQSGLGPPASQNVNSHVKEPAGLEEEEVSRTLGLVPRDQEPRGSHSPQRPQLHSPAQSEGPSSLCGKLKQALKPCPLEDKKPEDCKVPPRPLEAEGAQLQGGSNEWEVVVQVEDDGDGDYMSEPEAVLTRRKSNVIRKPCAAEPALSAGSLAAEPAENRKGTAVPVEC Predict reactive species\nFull Name: zinc finger and BTB domain containing 48\nCalculated Molecular Weight: 688 aa, 77 kDa\nObserved Molecular Weight: 77 kDa\nGenBank Accession Number: BC013573\nGene Symbol: ZBTB48\nGene ID (NCBI): 3104\nRRID: AB_2879664\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10074\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869794324649,"sku":"24665-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24665-1-ap","provider":"Iright","version":"1.0","type":"link"}