{"product_id":"proteintech-24688-1-ap","title":"Proteintech, 24688-1-AP, PRY Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRY (24688-1-AP) by Proteintech is a Polyclonal antibody targeting PRY in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n24688-1-AP targets PRY in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRY is Testis-specific PTP-BL-related Y protein which has two isoforms with MW 16 and 6-8 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20232 Product name: Recombinant human PRY2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-63 aa of BC153128 Sequence: MGATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFLWRY Predict reactive species\nFull Name: PTPN13-like, Y-linked 2\nCalculated Molecular Weight: 147 aa, 17 kDa\nObserved Molecular Weight: 7 kDa\nGenBank Accession Number: BC153128\nGene Symbol: PRY\nGene ID (NCBI): 442862\nRRID: AB_2879672\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14603\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887775502505,"sku":"24688-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24688-1-ap","provider":"Iright","version":"1.0","type":"link"}