{"product_id":"proteintech-24699-1-ap","title":"Proteintech, 24699-1-AP, LPLUNC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LPLUNC1 (24699-1-AP) by Proteintech is a Polyclonal antibody targeting LPLUNC1 in WB, ELISA applications with reactivity to human samples\n24699-1-AP targets LPLUNC1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human saliva\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLPLUNC1 (Long Palate, Lung and Nasal Epithelium Carcinoma-Associated Protein 1) is a member of the PLUNC protein family and is a secretory protein primarily expressed in the mucosal epithelium of the respiratory tract. As a key component of innate immunity, LPLUNC1 exhibits antimicrobial activity by directly binding to lipopolysaccharides and inhibiting bacterial growth. Recent studies have revealed that LPLUNC1 expression is significantly downregulated in various tumors, including nasopharyngeal carcinoma and lung cancer. It exerts tumor-suppressive effects by regulating signaling pathways such as NF-κB and STAT3, thereby inhibiting tumor cell proliferation and promoting apoptosis. Its expression level is closely associated with tumor stage and prognosis, making it a potential diagnostic biomarker and therapeutic target for cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20056 Product name: Recombinant human C20orf114 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 225-325 aa of BC008429 Sequence: LSIDRLEFDLLYPAIKGDTIQLYLGAKLLDSQGKVTKWFNNSAASLTMPTLDNIPFSLIVSQDVVKAAVAAVLSPEEFMVLLDSVLPESAHRLKSSIGLIN Predict reactive species\nFull Name: chromosome 20 open reading frame 114\nCalculated Molecular Weight: 484 aa, 52 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC008429\nGene Symbol: C20orf114\nGene ID (NCBI): 92747\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TDL5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887706034345,"sku":"24699-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24699-1-ap","provider":"Iright","version":"1.0","type":"link"}