{"product_id":"proteintech-24707-1-ap","title":"Proteintech, 24707-1-AP, TTYH3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TTYH3 (24707-1-AP) by Proteintech is a Polyclonal antibody targeting TTYH3 in WB, ELISA applications with reactivity to human samples\n24707-1-AP targets TTYH3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTweety homologs (TTYHs) are conserved transmembrane proteins present in all eukaryotes including three members (TTYH1, TTYH2, and TTYH3) in humans. They are widely expressed in mammals including at high levels in the nervous system and have been implicated in cancers and other diseases including epilepsy, chronic pain, and viral infections. Physiologically, TTYH2 and TTYH3 are broadly expressed, while expression of TTYH1 is primarily limited to the nervous system, testes, and stem cells. TTYH3 is upregulated in gastric cancer with higher expression correlated with poor clinical outcomes. (PMID: 34824283)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18804 Product name: Recombinant human TTYH3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 259-386 aa of BC131824 Sequence: LELAVSVGSSDFCVDPDAYVTKMVEEYSVLSGDILQYYLACSPRAANPFQQKLSGSHKALVEMQDVVAELLRTVPWEQPATKDPLLRVQEVLNGTEVNLQHLTALVDCRSLHLDYVQALTGFCYDGVE Predict reactive species\nFull Name: tweety homolog 3 (Drosophila)\nCalculated Molecular Weight: 523 aa, 58 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC131824\nGene Symbol: TTYH3\nGene ID (NCBI): 80727\nRRID: AB_3085749\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9C0H2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869782855849,"sku":"24707-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24707-1-ap","provider":"Iright","version":"1.0","type":"link"}