{"product_id":"proteintech-24708-1-ap","title":"Proteintech, 24708-1-AP, RNF151 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNF151 (24708-1-AP) by Proteintech is a Polyclonal antibody targeting RNF151 in WB, IHC, ELISA applications with reactivity to human,  mouse,  rat samples\n24708-1-AP targets RNF151 in WB, IHC, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat testis tissue,  human testis tissue,  mouse testis tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNF151 also termed as ring finger protein 151 is a 245 amino acid protein, which contains one Ring-type zinc finger and one TRAF-type zinc finger. RNF151, with, a putative nuclear localization signal (NLS)was exclusively expressed in the mouse testis and developmentally regulated during spermatogenesis. While RNF151 mRNA was present in round spermatids, its protein was expressed in elongating spermatids of the stage VIII-IX seminiferous tubules.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16606 Product name: Recombinant human RNF151 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-245 aa of BC113014 Sequence: MGGGYDLNLFASPPDSNFVCSVCHGVLKRPARLPCSHIFCKKCILRWLARQKTCPCCRKEVKRKKVVHMNKLRKTIGRLEVKCKNADAGCIVTCPLAHRKGHQDSCPFELTACPNEGCTSQVPRGTLAEHRQHCQQGSQQRCPLGCGATLDPAERARHNCYRELHNAWSVRQERRRPLLLSLLRRVRWLDQATSVVRRELAELSNFLEEDTALLEGAPQEEAEAAPEGNVGAEVVGEPRANIPCK Predict reactive species\nFull Name: ring finger protein 151\nCalculated Molecular Weight: 245 aa, 27 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC113014\nGene Symbol: RNF151\nGene ID (NCBI): 146310\nRRID: AB_2879683\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q2KHN1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887786315945,"sku":"24708-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24708-1-ap","provider":"Iright","version":"1.0","type":"link"}