{"product_id":"proteintech-24725-1-ap","title":"Proteintech, 24725-1-AP, FGFBP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FGFBP3 (24725-1-AP) by Proteintech is a Polyclonal antibody targeting FGFBP3 in WB, IF\/ICC, ELISA applications with reactivity to human,   mouse samples\n24725-1-AP targets FGFBP3 in WB, IF\/ICC, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFGFBP3 also named as C10orf13 or FGF binding protein 3 is 258 amino acid protein, which belongs to the fibroblast growth factor binding family. FGFBP3 is a secreted protein and may play a role in the regulation of gene transcription. The molecular weight of FGFBP3 is 29kDa, but our results detected the 60-65kDa protein by western blot. We infer that FGFBP3 may exist as dimer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20573 Product name: Recombinant human FGFBP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-258 aa of BC025966 Sequence: MTPPKLRASLSPSLLLLLSGCLLAAARREKGAASNVAEPVPGPTGGSSGRFLSPEQHACSWQLLLPAPEAAAGSELALRCQSPDGARHQCAYRGHPERCAAYAARRAHFWKQVLGGLRKKRRPCHDPAPLQARLCAGKKGHGAELRLVPRASPPARPTVAGFAGESKPRARNRGRTRERASGPAAGTPPPQSAPPKENPSERKTNEGKRKAALVPNEERPMGTGPDPDGLDGNAELTETYCAEKWHSLCNFFVNFWNG Predict reactive species\nFull Name: fibroblast growth factor binding protein 3\nCalculated Molecular Weight: 258 aa, 28 kDa\nObserved Molecular Weight: 60-65 kda\nGenBank Accession Number: BC025966\nGene Symbol: FGFBP3\nGene ID (NCBI): 143282\nRRID: AB_2879691\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TAT2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887639220393,"sku":"24725-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24725-1-ap","provider":"Iright","version":"1.0","type":"link"}