{"product_id":"proteintech-24727-1-ap","title":"Proteintech, 24727-1-AP, TRPC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRPC1 (24727-1-AP) by Proteintech is a Polyclonal antibody targeting TRPC1 in WB, IHC, ELISA applications with reactivity to human, mouse , rat samples\n24727-1-AP targets TRPC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse , rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRPC1, also named as TRP1, belongs to the transient receptor family and STrpC subfamily. TRPC1 is thought to form a receptor-activated non-selective calcium permeant cation channel. It has been reported that the mGluR1 evoked slow EPSC is mediated by the TRPC1 cation channel. It is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse , rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16488 Product name: Recombinant human TRPC1 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-349 aa of BC113953 Sequence: MMAALYPSTDLSGASSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTP Predict reactive species\nFull Name: transient receptor potential cation channel, subfamily C, member 1\nCalculated Molecular Weight: 793 aa, 91 kDa\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: BC113953\nGene Symbol: TRPC1\nGene ID (NCBI): 7220\nRRID: AB_3085750\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48995\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869781479593,"sku":"24727-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24727-1-ap","provider":"Iright","version":"1.0","type":"link"}