{"product_id":"proteintech-24732-1-ap","title":"Proteintech, 24732-1-AP, FAM172A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM172A (24732-1-AP) by Proteintech is a Polyclonal antibody targeting FAM172A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n24732-1-AP targets FAM172A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue, rat colon tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFamily with sequence similarity 172 member A (FAM172A), cloned from human aortic tissues, is subsequently observed in human endothelial and vascular smooth muscle cells, and macrophages. As the imbalance of the cell cycle and apoptosis is closely related to the key characteristics of malignant tumors, FAM172A dysregulation is a potential contributing factor in cell transformation. Recently, FAM172A has been reported to take part in the development of several cancers, such as human liver, colorectal and papillary thyroid cancers. Moreover, FAM172A was upregulated by high glucose in a concentration- and time-dependent manner which indicated that FAM172A may be involved in the pathogenesis of diabetic related diseases. FAM172A has 4 isoforms with the molecular mass of 34-36, 43 and 48 kDa. This antibody was detected at 50-55 kDa on SDS-PAGE. (PMID: 31988090, 26637224)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20437 Product name: Recombinant human FAM172A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 202-416 aa of BC020584 Sequence: NYIEVEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFYEKYRNPQREKEMMQLYIRENGSPEEHAIYVWDHFIAQAAAENVFFVAHSYGGLAFVELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSIFKFFTEASEAKTSSLKPAVTRRSHRIKHEEL Predict reactive species\nFull Name: family with sequence similarity 172, member A\nCalculated Molecular Weight: 416 aa, 48 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC020584\nGene Symbol: FAM172A\nGene ID (NCBI): 83989\nRRID: AB_2923572\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WUF8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887631847593,"sku":"24732-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24732-1-ap","provider":"Iright","version":"1.0","type":"link"}