{"product_id":"proteintech-24736-1-ap","title":"Proteintech, 24736-1-AP, ODF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ODF1 (24736-1-AP) by Proteintech is a Polyclonal antibody targeting ODF1 in WB, IHC, ELISA applications with reactivity to human,  rat,  mouse samples\n24736-1-AP targets ODF1 in WB, IHC, ELISA applications and shows reactivity with human,  rat,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat testis tissue,  mouse testis tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nODF1, also named as Outer dense fiber protein 1, is a 250 amino acid protein, which contains the  C-terminal contains many C-X-P repeats. ODF1 is a component of the outer dense fibers (ODF) of spermatozoa. ODF27 that suggested the possibility of inter- actions between ODF27 itself and\/or between ODF27 and other sperm tail proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, mouse\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20562 Product name: Recombinant human ODF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-250 aa of BC104457 Sequence: MAALSCLLDSVRRDIKKVDRELRQLRCIDEFSTRCLCDLYMHPYCCCDLHPYPYCLCYSKRSRSCGLCDLYPCCLCDYKLYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPCVDEKDVTYSYGLGSCVKIESPCYPCTSPCSPCSPCNPCNPCSPCNPCSPYDPCNPCYPCGSRFSCRKMIL Predict reactive species\nFull Name: outer dense fiber of sperm tails 1\nCalculated Molecular Weight: 250 aa, 28 kDa\nObserved Molecular Weight: 28 kDa, 56 kDa\nGenBank Accession Number: BC104457\nGene Symbol: ODF1\nGene ID (NCBI): 4956\nRRID: AB_2879697\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14990\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869420343465,"sku":"24736-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24736-1-ap","provider":"Iright","version":"1.0","type":"link"}