{"product_id":"proteintech-24744-1-ap","title":"Proteintech, 24744-1-AP, YTHDF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe YTHDF2 (24744-1-AP) by Proteintech is a Polyclonal antibody targeting YTHDF2 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n24744-1-AP targets YTHDF2 in WB, IHC, IF\/ICC, IF-P, IP, CoIP, chIP, RIP, ELISA, CLIP applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells,  HeLa cells,  MOLT-4 cells,  NIH\/3T3 cells,  C6 cells,  Raji cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF\/ICC detected in: U2OS cells, HeLa cells,  sodium arsenite treated HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nYTHDF2 also named as CLL associated antigen KW 14 or HGRG8 is a 579 amino acid protein, which contains one YTH domain and exists as two alternatively spliced isoforms. YTHDF2 is expressed in in pancreas, testis and placenta. YTHDF2 may play a role in human longevity. Due to the high sequence similarity, 24744-1-AP is likely to cross-react with both YTHDF1 and YTHDF3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, monkey, chicken, bovine, hamster, sheep, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5922 Product name: Recombinant human YTHDF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 339-565 aa of BC002559 Sequence: LSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQE Predict reactive species\nFull Name: YTH domain family, member 2\nCalculated Molecular Weight: 62 kDa\nObserved Molecular Weight: 62 kDa\nGenBank Accession Number: BC002559\nGene Symbol: YTHDF2\nGene ID (NCBI): 51441\nRRID: AB_2687435\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5A9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868820590761,"sku":"24744-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24744-1-ap","provider":"Iright","version":"1.0","type":"link"}