{"product_id":"proteintech-24750-1-ap","title":"Proteintech, 24750-1-AP, WWC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WWC2 (24750-1-AP) by Proteintech is a Polyclonal antibody targeting WWC2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n24750-1-AP targets WWC2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human kidney tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWWC2 alson named as BOMB or WW and C2 domain containing 2 is 1192 amino acid protein, which contains 1 C2 domain and 2 WW domains. WWC2 localizes in cytoplasm and belongs to the WWC family. , WWC2 exists as seven alternatively spliced isoforms and is encoded by a gene located on human chromosome 4q35.1. WWC2 may be expressed in liver, brain, prostate and kidney. The function of WWC2 is still non-known and need to be further studied.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20479 Product name: Recombinant human WWC2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1080-1165 aa of BC017957 Sequence: QSRLNDELQALRDLRQKLEELKAQGETDLPPGVLEDERFQRLLKQAEKQAEQSKEEQKQGLNAEKLMRQVSKDVCRLREQSQKVPR Predict reactive species\nFull Name: WW and C2 domain containing 2\nCalculated Molecular Weight: 1192 aa, 134 kDa\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: BC017957\nGene Symbol: WWC2\nGene ID (NCBI): 80014\nRRID: AB_2879704\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6AWC2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869628059817,"sku":"24750-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24750-1-ap","provider":"Iright","version":"1.0","type":"link"}