{"product_id":"proteintech-24766-1-ap","title":"Proteintech, 24766-1-AP, INSIG2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe INSIG2 (24766-1-AP) by Proteintech is a Polyclonal antibody targeting INSIG2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n24766-1-AP targets INSIG2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat liver tissue, A549 cells,  SGC-7901 cells\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nINSIG2 mediates feedback control of cholesterol synthesis by controlling SCAP and HMGCR. INSIG2 may bring HMGCR into ubiquitin-mediated proteasomal degradation. Insig2 protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. INSIG-2 may play an important role in therapy of hypercholesterolemia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14072 Product name: Recombinant human INSIG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 79-139 aa of BC022475 Sequence: TASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAA Predict reactive species\nFull Name: INSIG 2\nCalculated Molecular Weight: 225 aa, 25 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC022475\nGene Symbol: INSIG2\nGene ID (NCBI): 51141\nRRID: AB_2811285\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5U4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868885143721,"sku":"24766-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24766-1-ap","provider":"Iright","version":"1.0","type":"link"}