{"product_id":"proteintech-24805-1-ap","title":"Proteintech, 24805-1-AP, ZNF391 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF391 (24805-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF391 in IP, ELISA applications with reactivity to human,   mouse samples\n24805-1-AP targets ZNF391 in IP, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF391 is involved in transcriptional regulation. The calculated MW of ZFN391 is 358aa, 41 kDa. The immunogen of this antibody is 1-128aa of human ZNF391. No other protein can be recognized by this antibody from the sequence BLAST results.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20317 Product name: Recombinant human ZNF391 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC156667 Sequence: MESLRGNTAQGPTNEEDYKNEGQLSRQTKCPAQKKSSFENTVVRKVSVTLKEIFTGEEGPESSEFSLSPNLDAQQKIPKGHGSPISRKNSKDNSDLIKHQRLFSQRKPCKCNECEKAFSYQSDLLVHS Predict reactive species\nFull Name: zinc finger protein 391\nCalculated Molecular Weight: 3588 aa, 41 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC156667\nGene Symbol: ZNF391\nGene ID (NCBI): 346157\nRRID: AB_2879736\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UJN7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887948124329,"sku":"24805-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24805-1-ap","provider":"Iright","version":"1.0","type":"link"}