{"product_id":"proteintech-24856-1-ap","title":"Proteintech, 24856-1-AP, C19orf73 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C19orf73 (24856-1-AP) by Proteintech is a Polyclonal antibody targeting C19orf73 in IF\/ICC, ELISA applications with reactivity to human samples\n24856-1-AP targets C19orf73 in IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC19orf73, now officially named Autophagy-related protein 13, is a core regulatory factor in the initiation of cellular autophagy. As a key component of the ULK1\/ATG1 complex, this protein plays a critical role in responding to signals such as nutrient deprivation and energy stress. When the mTORC1 pathway is inhibited, ATG13 forms a stable activation complex with proteins including ULK1 and FIP200, initiating autophagosome formation. Dysfunction of ATG13 is closely associated with various diseases: in neurodegenerative disorders, impaired autophagy leads to abnormal protein aggregation; in tumor development, autophagy exerts dual regulatory effects on cancer progression. The expression level and activity of ATG13 are finely regulated by phosphorylation modifications, making it a crucial molecular switch connecting upstream signals with downstream autophagy execution machinery. It has become an important target in both fundamental autophagy research and the development of therapies for related diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21567 Product name: Recombinant human C19orf73 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC069712 Sequence: MRLKVGFQGGGCFRKDALCLEGGVSARWARAPHSAPLRPPRELHAAPPPATPTQTVVRPAGFPRRTRLMVRSAPPTQRPPTGSGCVSGLWRKGLGLRPQTLLRVGGVVLSSAPALRPRLGPCLRPPPSD Predict reactive species\nFull Name: chromosome 19 open reading frame 73\nCalculated Molecular Weight: 129 aa, 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC069712\nGene Symbol: C19orf73\nGene ID (NCBI): 55150\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NVV2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885506580649,"sku":"24856-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24856-1-ap","provider":"Iright","version":"1.0","type":"link"}