{"product_id":"proteintech-24857-1-ap","title":"Proteintech, 24857-1-AP, GPR45 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR45 (24857-1-AP) by Proteintech is a Polyclonal antibody targeting GPR45 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n24857-1-AP targets GPR45 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPR45 (G-protein coupled receptor 45) is a member of the G protein-coupled receptor (GPCR) family. Members of this protein family contain seven putative transmembrane domains and may mediate signaling processes to the interior of the cell via activation of heterotrimeric G proteins. GPR45 may function in the central nervous system.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21541 Product name: Recombinant human GPR45 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 332-372 aa of BC066879 Sequence: REACIELLPQTFQILPKVPERIRRRIQPSTVYVCNENQSAV Predict reactive species\nFull Name: G protein-coupled receptor 45\nCalculated Molecular Weight: 370 aa, 42 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC066879\nGene Symbol: GPR45\nGene ID (NCBI): 11250\nRRID: AB_3669457\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5Y3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887657832617,"sku":"24857-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24857-1-ap","provider":"Iright","version":"1.0","type":"link"}