{"product_id":"proteintech-24858-1-ap","title":"Proteintech, 24858-1-AP, NRBF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NRBF2 (24858-1-AP) by Proteintech is a Polyclonal antibody targeting NRBF2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n24858-1-AP targets NRBF2 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNRBF2 also termed as Nuclear receptor-binding factor 2or COPR is a 287 amino acid protein, which Interacts with PPARA, PPARD and PPARG. NRBF2 as transcription activator may modulate transcriptional activation by target nuclear receptors. NRBF2 is expressed in keratinocytes, liver and placenta. NRBF2, which exists as two isoforms due to alternative splicing, is localized to both the nucleus and the cytoplasm.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21403 Product name: Recombinant human NRBF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-287 aa of BC001345 Sequence: MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN Predict reactive species\nFull Name: nuclear receptor binding factor 2\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 35-37 kDa\nGenBank Accession Number: BC001345\nGene Symbol: NRBF2\nGene ID (NCBI): 29982\nRRID: AB_2879759\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96F24\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868970897577,"sku":"24858-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24858-1-ap","provider":"Iright","version":"1.0","type":"link"}