{"product_id":"proteintech-24864-1-ap","title":"Proteintech, 24864-1-AP, FUBP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FUBP1 (24864-1-AP) by Proteintech is a Polyclonal antibody targeting FUBP1 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n24864-1-AP targets FUBP1 in WB, IF\/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells,  Jurkat cells,  K-562 cells,  mouse brain tissue\nPositive IP detected in: SH-SY5Y cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFUBP1 also termed as FBP and FUSE-binding protein 1 is 644 amino-acid protein, which localizes in the nucleus. FUBP1 binds to a single-stranded far-upstream element (FUSE) upstream of the MYC promoter and regulates the MYC expression, indicating that FBP1 functions as a growth-dependent regulator of c-Myc expression. FUBP1 binds to FUSE, and PUF60, and forms a stable tripartite complex, which represses activated but not basal c-myc transcription after transcription initiation by delaying promoter escape.  FUBP1 may be acting both as activator and repressor of transcription.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13149 Product name: Recombinant human FUBP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 303-653 aa of BC017247 Sequence: DAGVRIQFKPDDGTTPERIAQITGPPDRCQHAAEIITDLLRSVQAGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPHGVPGPHGPPGPPGPGTPMGPYNPAPYNPGPPGPAPHGPPAPYAPQGWGNAYPHWQQQAPPDPAKAGTDPNSAAWAAYYAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAPTGAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPPAPQCRFDPASIELAL Predict reactive species\nFull Name: far upstream element (FUSE) binding protein 1\nCalculated Molecular Weight: 653 aa, 69 kDa\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: BC017247\nGene Symbol: FUBP1\nGene ID (NCBI): 8880\nRRID: AB_2879762\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96AE4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868941275305,"sku":"24864-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24864-1-ap","provider":"Iright","version":"1.0","type":"link"}