{"product_id":"proteintech-24866-1-ap","title":"Proteintech, 24866-1-AP, LRCH2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LRCH2 (24866-1-AP) by Proteintech is a Polyclonal antibody targeting LRCH2 in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n24866-1-AP targets LRCH2 in WB, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  mouse heart tissue,  mouse ovary tissue\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLeucine rich repeat and calponin homology domain containing protein 2 (LRCH2) also named as KIAA1495 is a 765 amino acid protein, which contains one CH domain and nine LRR repeats. The function of LRCH2 is still non-known.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21701 Product name: Recombinant human LRCH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 372-571 aa of BC125224 Sequence: HSQVSESNREQTSRNDSHIIGSKTDSQKDQEVYDFVDPNTEDVAVPEQGNAHIGSFVSFFKGKEKCSEKSRKNEELGDEKRLEKEQLLAEEEDDDLKEVTDLRKIAAQLLQQEQKNRILNHSTSVMRNKPKQTVECEKSVSADEVNSPLSPLTWQPLENQKDQIDEQPWPESHPIIWQSEERRRSKQIRKEYFKYKSMRK Predict reactive species\nFull Name: leucine-rich repeats and calponin homology (CH) domain containing 2\nCalculated Molecular Weight: 765 aa, 85 kDa\nObserved Molecular Weight: 84 kDa\nGenBank Accession Number: BC125224\nGene Symbol: LRCH2\nGene ID (NCBI): 57631\nRRID: AB_2879764\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5VUJ6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887707017385,"sku":"24866-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24866-1-ap","provider":"Iright","version":"1.0","type":"link"}