{"product_id":"proteintech-24898-1-ap","title":"Proteintech, 24898-1-AP, TMEM161A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM161A (24898-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM161A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n24898-1-AP targets TMEM161A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, mouse liver tissue,  rat liver tissue\nPositive IHC detected in: mouse brain tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM161A also named as transmembrane protein 161A is a 479 amino acid protein which belongs to TMEM161 family. The molecular weight of TMEM161A is 56 kDa or 42 kDa. TMEM161A is a multi-pass membrane protein and localizes to the cell membrane. It may be involved in the negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage and cellular response to oxidative stress.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18974 Product name: Recombinant human TMEM161A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 364-460 aa of BC005210 Sequence: VVRVYCYVTVVSLQYLTPLILTLNCTLLLKTLGGYSWGLGPAPLLSPDPSSASAAPIGSGEDEVQQTAARIAGALGGLLTPLFLRGVLAYLIWWTAA Predict reactive species\nFull Name: transmembrane protein 161A\nCalculated Molecular Weight: 479 aa, 54 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC005210\nGene Symbol: TMEM161A\nGene ID (NCBI): 54929\nRRID: AB_2879785\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NX61\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887830782121,"sku":"24898-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-24898-1-ap","provider":"Iright","version":"1.0","type":"link"}